DPCstruct | MC51148
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 213 ± 35 aa |
| Standard deviation of domain lengths | 34.77 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 71.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 22.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183VIQ5 | 1-162 | LDSDDDPDSDNDSLKPLPSTQCSSHSDKTPHYLRECLDGMLLTKVEDSKVNVSCTLSAEKLIRDHPEAARELALEFTNALIQVEPPV… |
| A0A3P7JRJ6 | 94-296 | AAENLPPDEPVLEKVDMQLPTSSSSVANSQPYDSDDEEDFKPYDIPESERNVEILPADAEPERSAPPPNYIRDCMEQLDEKEKYEVF… |
| A0A7E4RCX4 | 823-1025 | None |
| A0A819EHW9 | 823-1043 | None |
| A0A3F2RMG6 | 293-499 | None |
| A0A7C9E471 | 142-420 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.