DPCstruct | MC51146
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 100 ± 9 aa |
| Standard deviation of domain lengths | 9.09 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04577 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A540LS10 | 1-106 | MGPAQLPQVGKVQPYPRKFEGFIMSHIKNISLTSGPRSPSCKVQHNVSALVFSAGGYAGNFFHDFDDGFVLLFITVNTIFPDQDIVI… |
| A0A540LL86 | 33-129 | DPTGPTLVEKIKPYPRKFENSTMSRIKELTLISGPPGPKCHVQHTGPALVFSAGGYTGNVFHDFNDGFIPIFIVVHSILHDQAPILV… |
| A0A6A3AZR1 | 116-209 | None |
| J3MNP2 | 157-256 | None |
| A0A498IBG1 | 186-282 | None |
| A0A540LSK4 | 1-94 | None |
| A0A287K6L2 | 4-89 | None |
| A0A1R3HNQ8 | 56-145 | None |
| A0A4Y1RIJ5 | 209-293 | None |
| A0A803L1Y1 | 226-324 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.