DPCstruct | MC51145
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 57 ± 9 aa |
| Standard deviation of domain lengths | 8.56 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.70 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 49.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0327 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3WHF4 | 9-69 | SGRIPANYPQRGYLDGPLPKDPWNNEFQYICPGEHADFEIVSLGADGQTGGEGTGADIKSW |
| A0A318E3V0 | 185-231 | KSVRNDPWGNPYQYVSPGMRSEFDLFSFGSDGQSGGDGAAADIGNWD |
| A0A7Z9YV11 | 824-892 | None |
| A0A357ELP0 | 33-79 | None |
| A0A1H7A2V9 | 119-184 | None |
| A0A401JHX4 | 1-44 | None |
| A0A661GYC6 | 176-241 | None |
| A0A258BZZ8 | 173-233 | None |
| A0A0S7ZM09 | 33-95 | None |
| A0A6I0EBK0 | 14-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.