DPCstruct | MC5114
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 640 ± 91 aa |
| Standard deviation of domain lengths | 91.17 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 70.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813A9A1 | 270-847 | APLDPGFLPGYPAALAFQDWMEVSSSTLADVSEQSGVWWAAVVGAVTNTYERWLHATPLERLGISPEGHDALVTGRWARLNARVASM… |
| A0A812P7F7 | 17-574 | PALPPYTPESGSIDLINWVTHITPIMEDLSDSSSLWWTETLQDVMTWYTKYSTSTPLERVQLLPVRSSTAKPEWARVERRATAMMLT… |
| A0A1Q9C0I9 | 14-724 | None |
| A0A812X319 | 1-606 | None |
| A0A812WQG6 | 1-454 | None |
| A0A812K2M0 | 127-712 | None |
| A0A812IG87 | 446-1127 | None |
| A0A812JXR6 | 23-719 | None |
| A0A812Q7C7 | 27-618 | None |
| A0A812T0I5 | 216-864 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.