DPCstruct | MC51135
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 130 ± 13 aa |
| Standard deviation of domain lengths | 13.17 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q2TX54 | 4-145 | TVDLHAPSSSVRTPVGDLLLGPAHRGRLYLKGLRVPEPSRDEQTFRFGYNLVHGSVDRDRKRLVDAPEAMANVHSIWEKAIARDEVK… |
| A0A1C5NSM1 | 158-279 | YEKVTNSNLHLQGDYQKIETMYGDILESPEHKGKIFVGGLYICEEPRLDIGVDFKPCYVRLERDRNMVNSFDVCWYASKMVENAQNA… |
| S3BST4 | 341-508 | None |
| A0A370PHC4 | 277-415 | None |
| A0A2V5IQM4 | 298-437 | None |
| A0A6A5UDA5 | 227-356 | None |
| A0A5N5X429 | 118-263 | None |
| A0A0U5GP37 | 9-153 | None |
| V4A457 | 217-330 | None |
| A0A6M7YU40 | 458-579 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.