DPCstruct | MC51134
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 151 ± 20 aa |
| Standard deviation of domain lengths | 19.98 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 71.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U7PVH4 | 552-694 | CMDLPGDDTSNVAYVGTEVWSQPTARCDPPCTLVLPLSKLSSGTTISPGVITTSFEYGNTETTTVGGQAVTTFFSTVTTVSITVPAV… |
| K2RTW0 | 143-286 | CGGVNVYVPGSIWKDDPIMQCIPPCTFILPAYQLSTNTTITWPVLTTTVWSILEGSTITKLTSFTIPPFTTDEVRFWTVTADKTDTV… |
| U7PVI3 | 142-274 | None |
| A0A2T3Z092 | 794-915 | None |
| A0A179GXN8 | 335-491 | None |
| A0A2C5YCL2 | 137-292 | None |
| A0A2C5YEP2 | 158-341 | None |
| A0A2C5YJR5 | 270-390 | None |
| A0A074Y3F3 | 15-181 | None |
| A0A1E3BKE4 | 149-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.