DPCstruct | MC5113
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 244 ± 31 aa |
| Standard deviation of domain lengths | 31.30 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 14.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812P3Q9 | 4-245 | ARMLLSSLLVGALCQEPAPARTPEPEVESNVEVTLTPTAPSPDGSLRWSPKGAKVPVRPAPAGLIGEFHLGPAGTPPVRVALSYSPN… |
| A0A4U0F0W8 | 2-259 | TFDIAENYVSEFGKNSDMVTFSPLFKLESNTIYNNNQSGTIKAKPSFSNPSKIAYGFILFLGNSHSVFNRELTVLVENYDSTTPILH… |
| A0A2D6T4P1 | 11-233 | None |
| A0A7X7J0H9 | 8-253 | None |
| A0A3M1RMY8 | 92-339 | None |
| A0A517ZGU4 | 1-265 | None |
| A0A357D6A9 | 19-262 | None |
| A0A7X7E1R2 | 151-378 | None |
| A0A7X9KW12 | 1-199 | None |
| A0A4R1R911 | 19-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.