DPCstruct | MC51127
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 95 ± 6 aa |
| Standard deviation of domain lengths | 5.74 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 71.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 35.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M5WSW8 | 2-87 | TDRLSNEMVTVFVNHVDCYSSGIIGKVLAQAKVGATSVDEDDNLSQGSNQDQALTKDQCYQVIGTLKYNTSEKPDWVNSIIQYNNN |
| A0A2K5CQR2 | 1-102 | MAEEKETAAPTEKVLRLRRVFINLLDSYSSGNIGKFLSNCVVGASLEEITEEEEEEDENKSAMREASTTKVKEGTFQVVGTLSKPES… |
| A0A5J5CRF1 | 74-159 | None |
| A0A803Y8B0 | 1-100 | None |
| D2I4L3 | 1-99 | None |
| A0A158QEN3 | 1-94 | None |
| A0A5E4B6V2 | 1-99 | None |
| A0A7R9DDR4 | 53-149 | None |
| A0A7J8IF89 | 1-102 | None |
| A0A158R6R2 | 1-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.