DPCstruct | MC5112
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 228 ± 26 aa |
| Standard deviation of domain lengths | 25.87 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813ED74 | 1-190 | MESIQLSTQGSERQRKDLIRTALRFEKMLMHSAGDPSYQNLSQEAHLKKLFEAYNGFKANVAISKWQLSEDFMAGIINVIIGMSDEG… |
| A0A812MTY3 | 1-185 | MKVLARGKIREAPSPMTWVAGLLSLQQEGGWDHAVVIQQWNEQASKAERLVGGRFMTVKNILELEPSVRSVLQDAINQCGSPYSDDS… |
| A0A812JNU5 | 14-256 | None |
| A0A812I459 | 89-320 | None |
| A0A812Z5Z1 | 251-468 | None |
| A0A812YRE2 | 122-391 | None |
| A0A812I0Q9 | 129-352 | None |
| A0A812HGU5 | 32-253 | None |
| A0A813DTC3 | 11-210 | None |
| A0A1Q9BTQ7 | 210-452 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.