DPCstruct | MC51114
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 100 ± 17 aa |
| Standard deviation of domain lengths | 16.64 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 67.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E0K3R7 | 2-85 | ASASSSSSSFFDIEPLDGGEACLSGHAMDACSLCRKPLTRNCDIFMYRGNTPFCSEECRDHQMEMDEAAVRISATNARERAARN |
| A0A059AHX4 | 25-113 | RILVKPSLISTQIGKSSSALPLPPSNTARCCICDTDCFLKSCHLCQKRLSPHKDIYMYRGDEGFCSVECRERQIVIDEMTEMEMMAR… |
| A0A6V7PW03 | 33-134 | None |
| A0A835PNF8 | 9-106 | None |
| R7W481 | 34-136 | None |
| A0A5B6VQL3 | 71-179 | None |
| A0A218WR84 | 57-183 | None |
| A0A0A9PK32 | 28-100 | None |
| A0A0D6QUY2 | 133-251 | None |
| W1NE91 | 409-500 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.