DPCstruct | MC51111
Metacluster Properties and Pfam Annotations
| Number of structural domains | 121 |
|---|---|
| Mean domain length (aa) | 154 ± 34 aa |
| Standard deviation of domain lengths | 33.52 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 82.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.95 |
| Pfam Score | 89.55 |
| Assigned Pfam label(s) | PF00410- PF00347- PF01556- CL0267- PF02536 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A058ZZK7 | 1-130 | MKTILSSETMDIPDGVTIKVTAKMIEVEGPRGKLTRNFKHLNLDFQLIKDEETGKRKLRIEAWFGTRKTSAAIRTALSHVENLITDV… |
| A0A6L2PX34 | 449-622 | MKQIVTNQTVKIPKEVTVSVKSRLVTVKGPRGVLKRNFKHLALDIHLVHPKCLKVEKWFGTKKELAAVRTVCSHIENMIKGVTKGFL… |
| A0A6V8HNK8 | 423-586 | None |
| A0A1W9SJ11 | 2-151 | None |
| A0A7J6PDS1 | 690-844 | None |
| A0A816WRN4 | 1-84 | None |
| A0A1I8IC84 | 1-169 | None |
| A0A7J6L6J7 | 473-653 | None |
| A0A834T6P5 | 265-437 | None |
| C4JGZ7 | 48-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.