DPCstruct | MC5111
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 487 ± 38 aa |
| Standard deviation of domain lengths | 38.13 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 70.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812LUE3 | 1-580 | MTRAQYDRALGLDLNRTDLNLKAKKVVGTMKSARITQHSLLMGRIELMEHVDGLINPANAIAKMTPPTLLASLLKLQDEDVSLPFDL… |
| A0A812N2F4 | 192-679 | EQNLINRKPAGHQIRGARTVLETMEKNGNKEASTLKNRIVLVEHLDNLLHGPAYSTVPRAELLSHLSAVSHANLSLPTDLRLQLLER… |
| A0A812LI12 | 478-951 | None |
| A0A812JWJ2 | 1-460 | None |
| A0A812TBT1 | 338-810 | None |
| A0A812JVU4 | 2-493 | None |
| A0A812KM97 | 445-954 | None |
| A0A812M5T1 | 1-461 | None |
| A0A812H028 | 374-814 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.