DPCstruct | MC51109
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 158 ± 12 aa |
| Standard deviation of domain lengths | 12.14 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661ESB1 | 1-162 | MLRPRSELDPLLPVQLDDGSECPCVEITDPYSFRASIILPAWPAEFQDMRMRDFVEETLRRQAPAHLALRICWINYGQMQIFESRYR… |
| W4M228 | 1-168 | MHETIDLLYQLYSAEGFHLVEHLLLRPQQNGDPFLAPLFVNETEREQDPYSQRLSLIFPSGYARDFSRPPNTAIRTPVTPDRFRDVE… |
| A0A3P1C3T1 | 675-839 | None |
| A0A845W127 | 409-540 | None |
| A0A1M5UNJ8 | 934-1091 | None |
| A0A6I5PPM8 | 824-989 | None |
| A0A3M1TTE3 | 165-337 | None |
| A0A519RYN8 | 544-690 | None |
| A0A7V1LT93 | 159-304 | None |
| A0A2E4P8G1 | 310-476 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.