DPCstruct | MC51101
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 207 ± 15 aa |
| Standard deviation of domain lengths | 15.25 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183RLT2 | 1-194 | MSEGRTAIQRCEELISRWKSERNSPTFDPVPLLNNFSELLEEQINLFFSTDPDPFDDRHPLRTDSSCDLGQILRLLSSHDAFLERLT… |
| Q9W2F2 | 109-308 | TKKELTQIIDKWEQQQTQNGYDPVPTLRSLAEIFEREKDVYRRKDPDPLDSRHPYRADPSCQYGLLLKLLFRKDTFMGKLLNDYLRE… |
| G0NDT2 | 2-186 | None |
| A0A2B4RXT5 | 6-226 | None |
| A0A6V7WNG9 | 21-240 | None |
| Q21106 | 29-250 | None |
| J9JPT8 | 132-354 | None |
| A0A0N4U5D3 | 7-229 | None |
| A0A2S2R6P3 | 6-224 | None |
| A0A267F3B8 | 15-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.