DPCstruct | MC5110
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 346 ± 42 aa |
| Standard deviation of domain lengths | 41.91 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 26.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812Q3S5 | 3-337 | EVVYPGRSLQVSNDFAVLRLREAPEVEVAAATGEELRLRVSEDFRALSVEAKARDAKEAQGAAREAARRKANEERREAAARAEARAL… |
| A0A812LPS6 | 1-338 | MTTFQNDIEAAVEVDCGSGWVVLYPKQRLQIAGSAESLSIRLREDYTISSHVYIHAEAGLFSSEMCTSELGPFNIQAERWLEREKMS… |
| A0A812N5S6 | 71-385 | None |
| A0A812GCL5 | 37-416 | None |
| A0A812SXG4 | 7-322 | None |
| A0A813APQ5 | 1-340 | None |
| A0A812Q1M9 | 5-309 | None |
| A0A1Q9EKN8 | 280-661 | None |
| A0A812XAZ8 | 429-893 | None |
| A0A812R7R7 | 105-464 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.