DPCstruct | MC51099
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 109 ± 17 aa |
| Standard deviation of domain lengths | 16.58 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 46.13 |
| Pfam Score | 98.48 |
| Assigned Pfam label(s) | PF11669- PF03820 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A670IWB2 | 282-395 | SQLGTAYVSATTGAVATALGLNALTKHVSPLIGRFVPFAAVAAANCINIPLMRQRELKYGIPITDENGNRLGESSKAAQQAIVQVVI… |
| A0A0D8Y7G8 | 2-95 | ATALGANHILAKMKNTPKLVAALVPFIAVAAANAINIPMMRSNEFKVGIAIEDGNGKILGSSTIVPYYAILHVTISRICMAMPSMGG… |
| A0A4U1FNL1 | 101-218 | None |
| A0A6J3GE04 | 84-197 | None |
| L8Y997 | 145-253 | None |
| A0A553MM16 | 200-282 | None |
| A0A834NML0 | 9-142 | None |
| A0A653DFC0 | 9-116 | None |
| A0A2P4YJU3 | 50-180 | None |
| A0A158R353 | 125-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.