DPCstruct | MC51096
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 90 ± 8 aa |
| Standard deviation of domain lengths | 8.00 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D0HN43 | 1-96 | MASTLDQGDNQLLPSLFLVLPAPCVTNSRYLNEDKLEAMLKSLGYEMARKKLSAKLIYYLFRLVQGHEAVLNIKRQQWKKEEIRKGG… |
| U5HHE3 | 291-374 | KPQGLLFLVLPLPCLTNSRYMNHTRLEAILLTTGWAPVRRKDSAKLTYWLCKRVGDGSGDGKGWKREQLRGGIQRNNFAIIVNA |
| A0A317BEC5 | 53-151 | None |
| A0A4U0XEY9 | 204-291 | None |
| A0A376B9C7 | 276-357 | None |
| M2MJV1 | 497-577 | None |
| A0A7R9U5B3 | 188-277 | None |
| A0A7S4NL31 | 325-417 | None |
| A0A2B4STT8 | 570-647 | None |
| R8BTW3 | 46-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.