DPCstruct | MC51093
Metacluster Properties and Pfam Annotations
| Number of structural domains | 145 |
|---|---|
| Mean domain length (aa) | 223 ± 38 aa |
| Standard deviation of domain lengths | 37.54 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 15.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04865 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S5CFG3 | 6-162 | RSGKPADYRAWAMAAHPSVTGALVQPHALGPGTVLLRPICDGLTNRLPTTTILDAVSAYLPAVVPAVADWRVAAPLLDYVTITLALG… |
| A0A2D0HCC8 | 39-286 | NISAEAISYIVFHDVFNSGSTLQPHQPFPAIGGTAPEPLSQVKLYAPHLSHEKLERAITADDYAQLVMQHFPTKVQQATATLRWTGS… |
| A0A5K8AAG7 | 735-968 | None |
| E3IXC4 | 98-343 | None |
| A0A6P0VI65 | 93-315 | None |
| A0A6I6N988 | 799-1036 | None |
| A0A551X210 | 108-350 | None |
| A0A7K3HH64 | 333-587 | None |
| A0A661PQS9 | 194-449 | None |
| A0A7Y4X8W7 | 845-1073 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.