DPCstruct | MC5109
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 135 ± 11 aa |
| Standard deviation of domain lengths | 10.81 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 37.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812TGH2 | 344-483 | DKFRKRDSKRSASSWGPVYEGQILPQPSASVRSMRARLETPDMSYLQAYNHLEQLNPNQPWLTELEFLHAVLAHLSMFHEETAKNTY… |
| A0A812L4I5 | 1-120 | MHKFIAVDSGISSDHWGIFYKGYDDRALSVPEQTRRTYITSGAMPKARACIRKLDGSVPFRSRLEFVEGLAAIAAEFPEDMLRKVTG… |
| A0A812R182 | 843-959 | None |
| A0A813F343 | 309-441 | None |
| A0A813B1K8 | 1-144 | None |
| A0A1Q9C1T2 | 358-474 | None |
| A0A812JF53 | 749-889 | None |
| A0A1Q9DMF2 | 393-532 | None |
| A0A812GQ18 | 1110-1217 | None |
| A0A812TTB4 | 257-398 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.