DPCstruct | MC51082
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 52 ± 9 aa |
| Standard deviation of domain lengths | 8.63 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 48.63 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | PF02204- PF01754 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H9FT34 | 1-47 | MSLKSERRGIHVDQSDLLCKKGCGYYGNPVWQGFCSKHWREEYHKAR |
| A0A3B5KJE5 | 1-60 | CSHKSRRAIHVDQSELLCTKGCGFYGNQAWRGLCSKCWREENQREKQKQIQEDWALAERL |
| A0A183H5K1 | 16-62 | None |
| A0A1I7WWU4 | 15-77 | None |
| A0A0V0YCU8 | 2-43 | None |
| A0A6J1X2R1 | 18-60 | None |
| A0A7J5XVV4 | 41-99 | None |
| A0A5N5KAI0 | 52-102 | None |
| A0A671NZ62 | 1-68 | None |
| A0A672LUW1 | 1-58 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.