DPCstruct | MC5108
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 225 ± 20 aa |
| Standard deviation of domain lengths | 20.10 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812ZL51 | 13-219 | APLARVEAERHRANTKVWYERRLAVVVCEMALEEQLCQDGRSSRQISGRRSWFNRQTQGQTVDGVLLLTQPQLVQQRYNGVQSDVRL… |
| A0A812KAW1 | 426-644 | LGSSVESAGAADRRARADQLNAERHRENAKQWFKRRLVAILCEMALVDQLQEDGRSYRQVSGRISWFIRQCQGQSLDGILQLARPQL… |
| A0A1Q9DY39 | 646-856 | None |
| A0A1Q9EF85 | 270-477 | None |
| A0A812YJF2 | 23-229 | None |
| A0A1Q9CGF9 | 32-278 | None |
| A0A812WZQ6 | 1-231 | None |
| A0A1Q9D648 | 235-481 | None |
| A0A1Q9D7X5 | 712-931 | None |
| A0A1Q9DU81 | 404-621 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.