DPCstruct | MC51076
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 130 ± 16 aa |
| Standard deviation of domain lengths | 15.97 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 46.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4UJ38 | 236-375 | QCEIINCSGSEGNGGGIYANINFTPQQCIFKINDAIIQYCKARFNSSLVYPTGYGGGLFICGSGNYNASTNYLDFHGLKIFNNSADN… |
| A0A5J4TGP3 | 1-150 | MHCVCNRGNGGAIYIEVDLTTQFEFQIKDALIKECQAKTNITSSYPTGYGGGIFLSGIGDYDPYSNSLNFKGLNISNNSVDNRKQSI… |
| A0A5J4U7P2 | 93-249 | None |
| A0A5J4U5T5 | 52-187 | None |
| A0A5J4TW04 | 3-121 | None |
| A0A5J4V5Y0 | 429-585 | None |
| A0A5J4V1E2 | 355-498 | None |
| A0A5J4UZ93 | 168-320 | None |
| A0A5J4UX14 | 163-276 | None |
| A0A5J4UWD0 | 294-409 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.