DPCstruct | MC51070
Metacluster Properties and Pfam Annotations
| Number of structural domains | 196 |
|---|---|
| Mean domain length (aa) | 125 ± 22 aa |
| Standard deviation of domain lengths | 21.87 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 23.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G7F0H0 | 25-149 | KGAEKGKSFTKNGKTITYDKDGFPIFNSKFDVTLDASHLGTQKHGKHFQAANESIRKALIDDPSLAKKMNLTPMQHKFFMKSPSVQS… |
| A0A8A5FZJ9 | 2-103 | KLSKTSYPGVSRGRHFQEANESLLKAMESDKGFAQNMKGLGINLERTPTGLAPRKPPEGWTWHHELDEGVMRLVPRSQHTPGSEFWK… |
| A0A7T5SK17 | 18-159 | None |
| A0A4Q3JMG6 | 177-293 | None |
| A0A3G2FV91 | 387-494 | None |
| F4L5N3 | 857-980 | None |
| A0A2R7PBH1 | 406-517 | None |
| E5C6Z5 | 1-154 | None |
| D1YPL2 | 70-188 | None |
| A0A3M6ETY0 | 1-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.