DPCstruct | MC5107
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 156 ± 25 aa |
| Standard deviation of domain lengths | 25.39 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 17.41 |
| Pfam Score | 89.77 |
| Assigned Pfam label(s) | CL0167- CL0414 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812K5T6 | 230-394 | EGVRAQPKLLVGVQMIPLNITLDGKQYGTFAEEVWTYDPEREQAQTMQQMLRVMIVAALTDGQVDRFERDEIKTLYLDLTGLPLTDV… |
| C7Q5A1 | 1-197 | MIVWGWKTVFRVIGRGVFSCPTCGADRNYERRKAQRFFTLFFIPLIPLKVVGEFVRCTYCKNDFRDSVLARPTASQFTDLLQNTVRG… |
| A0A017HTM3 | 4-134 | None |
| A0A2G1Z517 | 120-271 | None |
| A0A7V9GFN1 | 19-153 | None |
| A0A3P3DCZ3 | 2-132 | None |
| A0A661FQ71 | 3-145 | None |
| A0A1X7L8P3 | 5-129 | None |
| A0A2T2UK21 | 4-133 | None |
| A0A661A8C1 | 330-475 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.