DPCstruct | MC51066
Metacluster Properties and Pfam Annotations
| Number of structural domains | 519 |
|---|---|
| Mean domain length (aa) | 198 ± 51 aa |
| Standard deviation of domain lengths | 51.04 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 86.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.85 |
| Pfam Score | 95.04 |
| Assigned Pfam label(s) | PF13946- PF11617- CL0592- CL0022- PF00427 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D4Y3E4 | 154-405 | VVNQKEMFTVTLEDYRLILDRQFVQRLYEKVFQRTADTAGLNDWSNKLYNGTTTGATTAWNFFFSPEFGNKNTTNEQYVNILYQALF… |
| A0A4R2NES4 | 670-877 | YVDFLRRTPDSAGLNYWVGQLNAGTSSRAELIESLMYSGEFRGRFGPLVRLYTAYFQRLPDYAGLMYWFDAMYPSSGTGNSITQVSD… |
| A0A3D0JYR3 | 19-211 | None |
| A0A7X2LVJ2 | 3-176 | None |
| A0A3M1T198 | 486-698 | None |
| A0A4V0I5X5 | 34-241 | None |
| A0A3D0K7P6 | 3-213 | None |
| A0A841MM09 | 833-1130 | None |
| A0A8A5CWY4 | 63-318 | None |
| A0A0Q4XEX4 | 51-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.