DPCstruct | MC51064
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 84 ± 5 aa |
| Standard deviation of domain lengths | 5.18 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 79.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B0CCS1 | 561-644 | EQLKSFIDPSKAPLIGLKTDRQAMGVAGRRRWFLVYDNVSSISPNASDIICQVATGFGYSTRTLFTTMDETIVEFTRPQAITAI |
| A0A1Q3SF34 | 735-818 | RFIRRLIDPSLTLLRAAPRDERDFWIGAQNSWMVAYDNLSGIPAWLSDTLCRVSTGGGNVTRLLYSDDEEVFFDARRPVLLNGI |
| Q1AVL8 | 317-404 | None |
| A0A847SNH6 | 741-821 | None |
| A0A161XJN0 | 37-120 | None |
| A0A6G3TRF0 | 215-295 | None |
| G7WRL0 | 630-709 | None |
| A0A256FRE4 | 119-205 | None |
| A0A7D6W0G4 | 1-95 | None |
| A0A3A9C0F8 | 268-358 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.