DPCstruct | MC51056
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 132 ± 13 aa |
| Standard deviation of domain lengths | 13.01 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A166EVE7 | 229-346 | LQCWIDHLHRYKSDKSTFPATVVQALRKAASRSWYGILLELRKITNAPEYTRPLINDWLAFGTALGFDEEKKRKEYNAMLAHICSWT… |
| A0A166J2C4 | 19-142 | ILSVYVVIAGGVQAQVGREQLHELLLQSVRPEWYRIIHDLRRRSKRDPQVAKKCEKLLSIWKKLGDTLDLVEDTERKEYERDMKRTA… |
| V2X4E5 | 264-404 | None |
| A0A166G0S9 | 353-474 | None |
| A0A6A4GYU2 | 343-466 | None |
| A0A166BG09 | 3-124 | None |
| V2WYB9 | 716-850 | None |
| A0A166I4N1 | 4-127 | None |
| A0A166BBY4 | 402-522 | None |
| A0A166LNA5 | 10-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.