DPCstruct | MC51053
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 155 ± 31 aa |
| Standard deviation of domain lengths | 31.40 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 31.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A166E9V1 | 130-246 | ILLPSGERLQVTARVRKSFFRYTEHPPDAQRGWDLPPGVLVSLEPTSTPALHRTSRTSQRVYTRPLLVDLATPDFSMPYNGIIMTCT… |
| A0A366NJX6 | 189-338 | RINGNINQQASIIEQVFYRPAIDRARGTQLELRMRIPPDSTVFLTYEFEKTILRYTEYPPDANRGFDVAAAVITTISPRVQSVRTTT… |
| A0A7R9FV84 | 414-563 | None |
| A0A6V7WN93 | 4-144 | None |
| A0A7S0YGH7 | 59-245 | None |
| K8F1W9 | 430-618 | None |
| A0A7J0FVR3 | 440-636 | None |
| B9IJL2 | 121-305 | None |
| T1F1V3 | 243-396 | None |
| A0A0B2PCW4 | 2-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.