DPCstruct | MC51052
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 127 ± 8 aa |
| Standard deviation of domain lengths | 8.06 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0407 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L6K203 | 6-115 | DLGEIARGIVNKEIQVYDGITRFGAYKPDEKWQELFGGVEPLKLSTSPQPYSIERTIRWLTYQVANSLALVSEADKIMQTEYMKMIQ… |
| A0A3E2X004 | 20-156 | LREDKAHTFAMLFKDNPLNLGKLAFDLLAGNLRFIVPDKKQSNRSHWKTCQFWNRFLGAVEPLQLHTETPRSTLLETQRWIKEGGVL… |
| A0A1S8T844 | 3-119 | None |
| A0A645FT98 | 3-136 | None |
| A0A268NTE7 | 123-245 | None |
| A0A1C3EZI0 | 63-187 | None |
| A0A6C2WBQ1 | 104-231 | None |
| D2JLH7 | 1-140 | None |
| A0A7Z9AX47 | 3-122 | None |
| A0A644WI17 | 46-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.