DPCstruct | MC51048
Metacluster Properties and Pfam Annotations
| Number of structural domains | 136 |
|---|---|
| Mean domain length (aa) | 125 ± 28 aa |
| Standard deviation of domain lengths | 27.82 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 84.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 19.40 |
| Pfam Score | 95.48 |
| Assigned Pfam label(s) | PF13657- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z8QPL1 | 2-120 | SRLNVYHEKTLVGYLSEDDKQELVFSYSHDWLTSKSAIALSPDLPLCEHLFEGNYVESFFENLLPEGDVLDFISQAEHISPGNVFGL… |
| A0A545T0S4 | 2-120 | KKQATVEIFREGHWWAAATITPADLAAGHNGACRMEYLLDYACEHIDDPQAVKAGVSCRYPVDFDLHDEQSWPAFLLDILPGGAGRA… |
| A0A084JF76 | 1-104 | None |
| A0A1E8F1B6 | 4-108 | None |
| A0A379AE19 | 112-210 | None |
| A0A7V1BHW5 | 131-328 | None |
| A0A2W4T091 | 2-115 | None |
| A0A1Q7JEC5 | 14-101 | None |
| A0A1X1QKX7 | 1-142 | None |
| A0A3G1KT96 | 4-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.