DPCstruct | MC5104
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 250 ± 53 aa |
| Standard deviation of domain lengths | 53.37 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 87.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 20.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812UYY3 | 106-404 | PVPFMESTWNVVLVMGLTDAGRLDELLGILLMLCSAVVQVMFGVVLLSRDFQGAPFENNLESASRWRRSLAHSHLHMDLAETSLVSR… |
| A0A812IVS1 | 37-257 | TYITVNGFHRGKAGAEPDLAGFRALSMEKKVEICSVPLSQPYFTYTILLIWTVTCLAEIRRAVRLLFSTLLSVPTVLVVEDVLKEKT… |
| A0A812Y7F1 | 127-409 | None |
| A0A812NEJ6 | 13-357 | None |
| A0A812NDZ4 | 90-347 | None |
| A0A812UFM7 | 39-252 | None |
| A0A812MH82 | 23-234 | None |
| A0A1Q9E872 | 104-399 | None |
| A0A812SYM6 | 2-164 | None |
| A0A812QAZ6 | 25-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.