DPCstruct | MC51038
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 76 ± 5 aa |
| Standard deviation of domain lengths | 4.85 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 56.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00547 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2QFS5 | 47-123 | ARNGDTVVQLMNKGQLLLGRKQVMHGVGDMIHDVQVEATFPDGTKLVTVSHPICKENGDLSLALYGSFLPVPDLAIF |
| A0A7J7NI79 | 47-119 | VRDGDKTVAELMDLGKQLLGRRQVLPAVPHLLHTVQVEGTFPDGTKLITVHDAIASEDGNLKLALHGSFLPGR |
| A0A180GFD4 | 1-66 | None |
| A0A6P4ZTS8 | 47-125 | None |
| A0A024UWJ6 | 47-123 | None |
| A0A1Y2CXY4 | 47-123 | None |
| A0A813IHD6 | 97-180 | None |
| A0A0C4F1Y7 | 103-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.