DPCstruct | MC51031
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 167 ± 35 aa |
| Standard deviation of domain lengths | 34.71 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 77.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.34 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | CL0662- PF10419 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453SUY8 | 1-100 | MIGNKSFPASLLDLPTVVESYKTYDDSFLVKAADIGQMVMVREDVDPAPEEVEYKHGLTPPMRDARRRRYRREPDLNAELVHRVEKD… |
| A0A1R2CRE3 | 7-167 | TILRLPEDWIRNFNSDWKLEFTPIDVENEDSGRFFKVKFGPLDTFSILLDLPCIVETHKTLDHINFFKSCDIAQMMFVIPEHEKQDP… |
| A0A2R6XJN8 | 2-168 | None |
| A0A0J9V559 | 168-308 | None |
| A0A182JQQ5 | 7-193 | None |
| A0A397SH43 | 71-233 | None |
| A0A482V9P0 | 6-125 | None |
| A0A182FTG3 | 371-558 | None |
| A0A7S0YIB8 | 12-164 | None |
| A0A7R9KD32 | 268-450 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.