DPCstruct | MC51030
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 388 ± 64 aa |
| Standard deviation of domain lengths | 64.49 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 73.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 23.30 |
| Pfam Score | 85.71 |
| Assigned Pfam label(s) | CL0357- CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R2CLN3 | 2-346 | NALHIKIYPSEPRERPDNGKSIQKPYSLKYTTDFLISKKGTALVCVQANEKEKLGKNDRLIATVSLNEGIYMMKILKSMLNSYSDTF… |
| A0A061D6J7 | 2-404 | LRVCTRTWTRDSHDLFDYETQDPKQLAERHFAASNSFRLLRTESTVSPVTALSQTDATNGERERDHLLSVFCRRPGEYTLAPAERVP… |
| A0A7R9U7Z2 | 31-445 | None |
| A0A813JU27 | 160-560 | None |
| Q22AQ9 | 65-487 | None |
| A0A1R2CM88 | 2-409 | None |
| R1C7L7 | 8-310 | None |
| Q4UH28 | 3-496 | None |
| A0A7J6PMV6 | 1-270 | None |
| G5A1T1 | 23-450 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.