DPCstruct | MC5103
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 82 ± 6 aa |
| Standard deviation of domain lengths | 5.91 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 48.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1PTK6 | 18-97 | GANAVRLYGNDPRLDHSAFLDEAAQQGLQVIAGFSDYPFIQMPGSCMQTDRDCFKQIRTQYALNLRSGFLSAPKTYHRAL |
| A0A812I8D4 | 1-84 | MGAKMLRLYGNDPRFDGKKFLDYANRWGLKVVAGISDYPYEHGPGKCWKNDLNCYEAIRESYSATLENKSFVAHGKYHPALDTL |
| A0A812Q6U4 | 68-148 | None |
| A0A812SQ34 | 293-389 | None |
| A0A812SS24 | 59-136 | None |
| A0A812Z7C8 | 315-395 | None |
| A0A812ZY75 | 2-78 | None |
| A0A812Q3N8 | 62-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.