DPCstruct | MC51028
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 144 ± 40 aa |
| Standard deviation of domain lengths | 39.60 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 82.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 21.63 |
| Pfam Score | 29.46 |
| Assigned Pfam label(s) | CL0322- PF15915- PF04461- PF07549 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A259P2U4 | 1-128 | MPSFDVVCEPDMIELKNAIEQSNKEITNRFDFKGSDSRVEQKDETLILFGDDDFKLGQVRDVLISKMAKRNVDVRYLKDDKTETIGG… |
| A0A485CZ84 | 1-109 | MPSFDIVSEVDLQEARNAVDNASREVESRFDFRGVEATFELNDANKTIKVLSESDFQVNQLLDILRAKLLKRGIEGTSLDVPEDFVH… |
| A0A1V6BKT5 | 1-91 | None |
| A0A2X2BZQ7 | 25-123 | None |
| A0A2A2K0M0 | 16-187 | None |
| A0A377F887 | 1-121 | None |
| A0A376U489 | 2-157 | None |
| A0A2D9HC78 | 49-197 | None |
| A0A7R9AEA2 | 55-183 | None |
| A0A2A3GM69 | 79-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.