DPCstruct | MC51025
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 100 ± 11 aa |
| Standard deviation of domain lengths | 10.57 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 36.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02698 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A485CQC4 | 13-126 | EVPVATLVQDPTMQRRTMATFSRAWQDVTVSPKWVSYPGYIPLLQNTSDGVAWQQPAEGLWSVGRYLSLILGELPRLRDDAQGYGPR… |
| A0A1H0FEW2 | 8-98 | HPASIMLISRPYQQRRAYATCRKVWPEVEVICSSRPLPLDEYIATIGDVDRVITMLVGDTQRITQYARLGFAIEQDVPEPVHAAYQR… |
| A0A1Y4RJR2 | 219-332 | None |
| A0A4R2HX41 | 7-109 | None |
| A0A4Q2HHC8 | 48-138 | None |
| A0A6C7I0E6 | 155-248 | None |
| A0A837RI61 | 2-96 | None |
| A0A7Z1MX67 | 16-108 | None |
| A0A377BH12 | 7-94 | None |
| A0A6C2TY32 | 461-567 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.