DPCstruct | MC51024
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 217 ± 46 aa |
| Standard deviation of domain lengths | 46.29 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 84.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 54.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A485CJF6 | 2-225 | AFTIPLALFMGIYIRYLRPGRIGEVSVIGLVLLVFAIISGGWVAASETWAPWFDYTGVQLTWMLVGYGFVASVLPVWLLLAPRDYLS… |
| A0A2W4N0K4 | 142-356 | IAMAGLGNVVVGALAESAWGVFTVGLSIPIALLMGIHIYGVRGGSVRGIREASIGGVILLAVALVAGKFVADSGYADLFRHSKTTLT… |
| A0A257SNC3 | 2-197 | None |
| A0A832FUZ2 | 105-300 | None |
| A0A087A716 | 77-412 | None |
| A0A3S4IW15 | 19-215 | None |
| A0A1V2MBX2 | 28-261 | None |
| A0A379WFY3 | 2-183 | None |
| A0A330PID2 | 39-236 | None |
| A0A833KPU7 | 26-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.