DPCstruct | MC51018
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 77 ± 8 aa |
| Standard deviation of domain lengths | 7.86 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 66.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01992 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A078I8D6 | 1-72 | MDIEIMRNTLYKAYLEDFYKFCQKLDGATSETMSDLLAFEADRRAVNITINSIGTELTREDRKKLYSNFGLL |
| R7QLV0 | 275-344 | IEIIRNTLYKAYLQDFYAYCIKMGGATAELMGEILKFEADRRAINITINSFGTELTKHEREKLYPTIGTL |
| A0A072TVS5 | 121-194 | None |
| A0A4V3WIS0 | 173-265 | None |
| A0A183EJH1 | 154-226 | None |
| A0A812U2C8 | 60-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.