DPCstruct | MC51017
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 416 ± 83 aa |
| Standard deviation of domain lengths | 83.28 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 73.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 43.16 |
| Pfam Score | 80.00 |
| Assigned Pfam label(s) | CL0023- CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A078I5W8 | 1-411 | MGAMPEGRKCVTCIGLGIDESNRRSLGKCSRMLKRVLTDSELKHVMSNEMSCRANQMPSRLIAVNGKPLNEDELFMLQNCPHPPKKL… |
| A0A1D6KEZ8 | 1-322 | MGSMPEGRKCLECIGRPVAESRRDALGRGSRVLRRLLSAAEVELVMRSERECAANQLRAEDVYVNGSKLSPEELVVLQGCPCPPSRL… |
| A0A2Z6PPZ7 | 156-644 | None |
| A0A2Z6MNX3 | 177-452 | None |
| A0A5J5BJR7 | 208-684 | None |
| A0A453MPE7 | 1-374 | None |
| A0A5D2W9Q2 | 68-544 | None |
| A9T0U3 | 1-393 | None |
| M4DMB5 | 152-459 | None |
| K7N0M4 | 195-472 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.