DPCstruct | MC51014
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 93 ± 6 aa |
| Standard deviation of domain lengths | 6.07 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 56.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A078HYM6 | 2-94 | GAAPDHLFNLRNQFYLGAYQTAINNSEIPHLSPEDAVERDCLVFRSYIALGSYQLVISEIDESAATPLQAVKLLAMYLSSPAHKLVC… |
| B1WBX7 | 11-112 | GSSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSSPEREVERDVFLYRAYLAQRKYGVVLDEIKPSSAPELQAVRMFAEYLASENRR… |
| A0A1D6QER4 | 1-85 | None |
| A0A4D9BBL9 | 298-390 | None |
| A0A0B0N4E3 | 37-129 | None |
| B6SJT7 | 2-91 | None |
| A0A2U1PI82 | 2-93 | None |
| A0A7J9LCJ8 | 3-94 | None |
| A0A1Y3NGG1 | 1-106 | None |
| A0A2H5N0Q0 | 1-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.