DPCstruct | MC51011
Metacluster Properties and Pfam Annotations
| Number of structural domains | 85 |
|---|---|
| Mean domain length (aa) | 92 ± 11 aa |
| Standard deviation of domain lengths | 11.15 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0093 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A078HRY0 | 7-94 | MTLRERHVDSGILLSGCQADETSADVGGGGGKAYGAFSNAIQTVLKENECALKNKELVMMAREVLERLGFQQHPCLYCSDQNADATFL |
| A0A0A9DRE6 | 13-100 | AGTTARVRSNGVLISGCQTDQTSADATTPKGVSYGALSNAIQAILTEHGTVTNKELVLKARKMLSKQGYTQQPGLYCSDEHASVAFIC |
| A0A399WU16 | 195-287 | None |
| A0A7J7DVL4 | 39-131 | None |
| A0A6V7NFL5 | 2-79 | None |
| A0A2G8Y4Y5 | 104-188 | None |
| A0A7Z0QI51 | 385-482 | None |
| A0A517ZIU8 | 215-290 | None |
| A0A838RYH2 | 339-437 | None |
| A0A1F4A0T2 | 199-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.