DPCstruct | MC5101
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 76 ± 10 aa |
| Standard deviation of domain lengths | 10.03 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A117EB27 | 2-74 | LALASLAVLLTAAGYAALCFVQPFAPCRKCSGTGIREARRKVKLCRRCHGHRYRLRTGRRLLNTGRTVHHAGT |
| D2PN84 | 24-110 | LPLAADLTVTVHTITQAATVTLIVTGVIAFYLLTCLIWPFGRCRRCNGAGKHKSPFGKAYRYCGRCQGSGMRVRIGRHVINYIRAAR |
| A0A1H6E1D3 | 16-88 | None |
| A0A544ZM10 | 2-69 | None |
| A0A6N7IHC6 | 1-87 | None |
| A0A3N1LCQ1 | 15-95 | None |
| A0A1T3NYP2 | 4-93 | None |
| A0A7K0C1D7 | 41-113 | None |
| A0A4R6K900 | 19-94 | None |
| A0A7J9XH49 | 1-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.