DPCstruct | MC51009
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 284 ± 18 aa |
| Standard deviation of domain lengths | 17.53 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 65.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U2BSY9 | 93-339 | QDRPDWSSLAFDELGDDDESDGALSEGWDDWDALDEDELPPIELSERESGDDLLQDFSDEDALSPEEIARIRARRSASVVAAELDVS… |
| A0A2D9ZXX4 | 1-295 | MDKDEYEDSAEESDSDDSEEFETSDFEEIDDLEDIDVFNEETFDPEEEWLADDDFDADFIDSLVDERDYPPESENTGGITRRERANQ… |
| A0A1R3FMP3 | 178-474 | None |
| A0A1B1YQ86 | 1-263 | None |
| A0A2D5RXK2 | 405-689 | None |
| A0A7U0GEH1 | 381-677 | None |
| A0A2K2H5S8 | 147-422 | None |
| A0A7Z0N6E6 | 254-554 | None |
| A0A5B7YF91 | 301-596 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.