DPCstruct | MC51005
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 198 ± 38 aa |
| Standard deviation of domain lengths | 38.44 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 21.15 |
| Pfam Score | 71.14 |
| Assigned Pfam label(s) | CL0197- CL0073- CL0026 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8KDR3 | 1-192 | MATAELYLTGIVVSLDVDIYRSGQVEMASDKQAKKNWIWGPSGWGAILLVNCSPPDMVQLTDKRTTKVFFAEEVKNLSQMMLNVQGP… |
| A0A7V6I580 | 67-241 | VIKIDLDIDTNFDALISDADESTEESDGGVVGLNLDDDNGNGTADKDDTGSVIGENDLEPITLTRDPPTLSSGMLTLEAISGGNKIK… |
| D9X4P2 | 112-321 | None |
| W7MM63 | 1-195 | None |
| A0A348PE94 | 576-757 | None |
| A0A5Q4ESD8 | 75-302 | None |
| A0A5C5Z9L3 | 733-896 | None |
| W6YJ59 | 6-184 | None |
| A0A419HDR0 | 1-190 | None |
| A0A151GVC1 | 2-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.