DPCstruct | MC51002
Metacluster Properties and Pfam Annotations
| Number of structural domains | 129 |
|---|---|
| Mean domain length (aa) | 214 ± 36 aa |
| Standard deviation of domain lengths | 36.46 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.36 |
| Pfam Score | 96.83 |
| Assigned Pfam label(s) | CL0220- CL0030 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8JJJ1 | 415-650 | LRHTNTVYYNEFLHNQFFVDLDTVTKLQDIYSWLNDVLVPLLHNSLNPTFLPESASVILGLPLMRQVRAKSGETACPPAKNFVQSSI… |
| A0A2H1CP79 | 9-152 | WYNDVPMRDDTRLSIGYDNLLIGVPRLRQVRMASNSCMIPMDFRSDIKECFGQYDITKEDKSPFGLQNGTAWQYTSPDDLDMSSFWG… |
| Q2EG98 | 1693-1901 | None |
| A0A820J8F3 | 17-207 | None |
| A0A820JBH0 | 5-140 | None |
| A0A812XWW8 | 102-347 | None |
| A0A3Q0J7Q0 | 7-172 | None |
| A0A0V0Q9Z3 | 296-476 | None |
| A0A061R3P0 | 113-325 | None |
| A0A061R8S4 | 190-392 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.