DPCstruct | MC51001
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 148 ± 13 aa |
| Standard deviation of domain lengths | 12.56 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 74.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 57.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16206 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8JJ21 | 1-158 | MTLTEVQEAEIDIRLREEFSKMCFETLLQFSFSNKVTTPQEGYISRMALSVLLKRSQDVLHRYIEDERLSGKCPLPRQQVTEIIFVL… |
| A0A7R9LRD0 | 3-131 | SGNDLTPDHSIGIVNKLAVTSILQRFNEVVIKYVEDERLCPCPLPRHRMAEISFVLKALATLIVSLKKAPVGSVEPHVWDLLIRLYP… |
| A0A4Z2HQV3 | 851-1000 | None |
| Q6GP04 | 1570-1721 | None |
| V4AFH7 | 537-677 | None |
| H9JV34 | 40-178 | None |
| A0A812D7N7 | 322-461 | None |
| E9IJ77 | 92-271 | None |
| A0A3B3D441 | 79-229 | None |
| A0A6P6MCV6 | 1-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.