DPCstruct | MC5100
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 100 ± 15 aa |
| Standard deviation of domain lengths | 14.93 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 68.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12480 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8CFX0 | 34-126 | FPLQFIQLFVHNESRWQLKVKFRTGRAFYLQLRAPPETRDREFGQWVRLLYRLRFHSAEGAVPFTQEYSALEDWEEGDEDEEEDEDE… |
| A0A6P7R8K2 | 1-110 | MLFPLQFVQLFVHDESRQQLKVKFRTGRAFYLQLRSPPETRDCEFGRWVRLLYRLRFHSPTCAVPFTHEDTAPEEEEEEEEEVKEGQ… |
| G1T259 | 101-186 | None |
| A0A674J1Y7 | 95-198 | None |
| A0A7J8JUN1 | 32-152 | None |
| A0A7N4NTR2 | 36-125 | None |
| F1PKZ9 | 126-238 | None |
| A0A226NHY2 | 113-230 | None |
| A0A7J8C7A1 | 1-93 | None |
| A0A6I9XWG6 | 68-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.