DPCstruct | MC510
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 246 ± 26 aa |
| Standard deviation of domain lengths | 25.81 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 70.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 49.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A8YW87 | 4-202 | VRQLLQSLRFCIMKLLKLEGSEWLFKQNGGCDENLIDQLAESERVLQKETTSDRDADCIHKLPNCGDGCVWQASLVVSFGVWCIHRV… |
| A0A6G1BQX2 | 3-237 | KDDFSYKESEAKLLQSLRFCILKLLKLEGSGWLFKQNGGSDEDLIDQVAAVEKLLQQGTSDNLLSHSDSQQPCDKADIQYMRVLPNC… |
| A0A3L6QFG3 | 87-294 | None |
| A0A0P0X2N3 | 342-601 | None |
| A0A446LXV7 | 35-256 | None |
| A0A5N6Q5C9 | 860-1113 | None |
| A0A1Z5RNP0 | 412-638 | None |
| A0A059A112 | 1030-1256 | None |
| A0A5P1F1X4 | 420-661 | None |
| A0A7S5GBN6 | 704-988 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.