DPCstruct | MC51
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 131 ± 9 aa |
| Standard deviation of domain lengths | 9.37 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 23.29 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | PF14480- CL0494 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A061NCJ1 | 1-125 | MSDHVRQERFQLLLEQIGIPEEIKEKELREGSIERLEVNRQKRHWQFYIQLPSPVTPLVFEMLEEKLVLAFREIASVGFTMSFKTGA… |
| T0U435 | 1-125 | MSKERETFEILLEQINAGPDLRQHPLIQTAQIKQVVVHRQSKAWTFYLQFDTLLPVMVYQSFKQHLELAFKEIAAVRMIIEAKDNAF… |
| A0A0M2ZQ18 | 1-140 | None |
| W1VII1 | 1-141 | None |
| W4VEJ2 | 1-122 | None |
| E1NUX0 | 1-121 | None |
| T0TSY0 | 1-143 | None |
| X0PFP6 | 1-141 | None |
| W4RHC0 | 8-126 | None |
| Q8EQU6 | 8-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.